Detailed information of auxiliary protein

Auxiliary protein


ID   45 GenBank   NP_862918
Name   TraY_p1658/97 insolico UniProt ID   Q7B3W9
Length   131 a.a. PDB ID   _
Note   conjugal transfer protein TraY

  Protein sequence


Download         Length: 131 a.a.        Molecular weight: 15183.38 Da        Isoelectric Point: 9.9240

>NP_862918.1 conjugal transfer protein TraY (plasmid) [Escherichia coli]
MKRFGTRSATGKMVKLKLPVDVESLLIEASNRSGRSRSFEAVIRLKDHLHRYPKFNRAGNIYGKSLVKYL
TMRLDDETNQLLIAAKNRSGWCKTDEAADRVIDHLIKFPDFYNSEIFREADKEEDITFNTL

  Protein domains


Predicted by InterproScan

(70-117)

(16-59)

  Protein structure


Source ID Structure
AlphaFold DB Q7B3W9

  Reference


[1] Zienkiewicz M et al. (2007) Mosaic structure of p1658/97, a 125-kilobase plasmid harboring an active amplicon with the extended-spectrum beta-lactamase gene blaSHV-5. Antimicrob Agents Chemother . 51(4):1164-71. [PMID:17220406]