Detailed information of auxiliary protein

Auxiliary protein


ID   44 GenBank   NP_862916
Name   TraY_p1658/97 insolico UniProt ID   Q84A34
Length   127 a.a. PDB ID   _
Note   conjugal transfer protein TraM

  Protein sequence


Download         Length: 127 a.a.        Molecular weight: 14517.48 Da        Isoelectric Point: 5.0516

>NP_862916.1 conjugal transfer protein TraM (plasmid) [Escherichia coli]
MAKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQMERKESAFNQTEFNKLL
LECVVKTQSSVAKILGIESLSPHVSGNPKFEYANMVEDIREKVSSEMERFFPKNDDE

  Protein domains


Predicted by InterproScan

(1-126)

  Protein structure


Source ID Structure
AlphaFold DB Q84A34

  Reference


[1] Zienkiewicz M et al. (2007) Mosaic structure of p1658/97, a 125-kilobase plasmid harboring an active amplicon with the extended-spectrum beta-lactamase gene blaSHV-5. Antimicrob Agents Chemother . 51(4):1164-71. [PMID:17220406]