Detailed information of auxiliary protein

Auxiliary protein

• ID: 42
• GenBank: YP_001961051
• Name: TraD_pRi2659
• UniProt ID: A8W092
• Length: 102 a.a.
• PDB ID: _
• Note: probable traC gene, Ti plasmid conjugal DNA processing; similar to riorf111 in pRi1724

Protein sequence

• Length: 102 a.a.
• Molecular weight: 10259.32 Da
• Isoelectric Point: 5.2518

>YP_001961051.1 rcorf76 (plasmid) [Agrobacterium rhizogenes]
MKKPASKIRDEIAKLQEQLKVAETREAERIGRIALKAGLGEIEIEEGELQAAFEEVATRFRGGQGGGKGA
TNGGKKGAGDSSGATSTPADSSGAGAGSTGEA

Protein domains

Predicted by InterproScan

• TraC-like protein (TraC) (2-101)

Protein structure

• AlphaFold DB: A8W092