Detailed information of auxiliary protein

Auxiliary protein


ID   41 GenBank   YP_004823732
Name   NikA_R621a insolico UniProt ID   Q79VV8
Length   111 a.a. PDB ID   _
Note   NikA oriT-specific DNA-binding protein

  Protein sequence


Download         Length: 111 a.a.        Molecular weight: 12613.57 Da        Isoelectric Point: 10.7463

>YP_004823732.1 NikA oriT-specific DNA-binding protein (plasmid) [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB Q79VV8

  Reference


[1] Takahashi H et al. (2011) The genome sequence of the incompatibility group I纬 plasmid R621a: evolution of IncI plasmids. Plasmid. 66(2):112-21. [PMID:21763721]