Detailed information of auxiliary protein
Auxiliary protein
ID | 40 | GenBank | CAD24399 |
Name | TraK_pB4 | UniProt ID | Q8RSG7 |
Length | 137 a.a. | PDB ID | _ |
Note | _ |
Protein sequence
Download Length: 137 a.a. Molecular weight: 15067.19 Da Isoelectric Point: 10.3031
>CAD24399.1 TraK protein (plasmid) [uncultured bacterium]
MAKSLSDRIAERMSARKPTGAGKNRAEFLAMRNDVKKAMDDGWPVKVIWETLRDEGKISFGYDAFIGYVN
RLIRNVDATAPAPVPPSTADQAKGQKPAQQEGGSKAKKPKPAEPKKTEPSGIASFNYNPKMEDKDLF
MAKSLSDRIAERMSARKPTGAGKNRAEFLAMRNDVKKAMDDGWPVKVIWETLRDEGKISFGYDAFIGYVN
RLIRNVDATAPAPVPPSTADQAKGQKPAQQEGGSKAKKPKPAEPKKTEPSGIASFNYNPKMEDKDLF
Protein domains
Predicted by InterproScan
Protein structure
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q8RSG7 |
Reference
[1] Tauch A et al. (2003) The 79,370-bp conjugative plasmid pB4 consists of an IncP-1beta backbone loaded with a chromate resistance transposon, the strA-strB streptomycin resistance gene pair, the oxacillinase gene bla(NPS-1), and a tripartite antibiotic efflux system of the resistance-nodulation-division family. Mol Genet Genomics. 268(5):570-84. [PMID:12589432]