Detailed information of auxiliary protein
Auxiliary protein
| ID | 4 | GenBank | CAJ85726 |
| Name | TraK_RK2  |
UniProt ID | A6H978 |
| Length | 119 a.a. | PDB ID | _ |
| Note | relaxosome stabilisation | ||
Protein sequence
Download Length: 119 a.a. Molecular weight: 12869.28 Da Isoelectric Point: 4.1047
>CAJ85726.1 TPA: TraH protein (plasmid) [Birmingham IncP-alpha plasmid]
MSNPNEMTDEEIAAAMEAFDLPQPEPPSTPQAATATDGTLAPSAPAEPSHSASPTLDALDESRRPKAKTV
CERCPNSVWFASPAELKCYCRVMFLVTWSSKEPNQLTHCDGEFLGQEEG
MSNPNEMTDEEIAAAMEAFDLPQPEPPSTPQAATATDGTLAPSAPAEPSHSASPTLDALDESRRPKAKTV
CERCPNSVWFASPAELKCYCRVMFLVTWSSKEPNQLTHCDGEFLGQEEG
Protein domains
No domain identified.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6H978 |
Reference
[1] Zatyka M et al. (1994) Location and nucleotide sequence of the transfer origin of the broad host range plasmid RK2. Microbiology. 140 ( Pt 11):2981-90. [PMID:7812437]
[2] Waters VL et al. (1991) Sequence identity in the nick regions of IncP plasmid transfer origins and T-DNA borders of Agrobacterium Ti plasmids. Proc Natl Acad Sci U S A. 88(4):1456-60. [PMID:1996345]