Detailed information of auxiliary protein

Auxiliary protein


ID   393 GenBank   ABQ56694
Name   traK_Trb-1 experimental UniProt ID   _
Length   108 a.a. PDB ID   _
Note   

  Protein sequence


Download         Length: 108 a.a.        Molecular weight: 12488.28 Da        Isoelectric Point: 9.8029

>ABQ56694.1 TraK [Legionella pneumophila str. Corby]
MKKPLSERVIQNQSEKKNGRTNAKIQFIALKEDIREALDKGCSMKAVWETLSDEGQISFGYKAFRHYVLK
LIKSEQENIRDDKQSKSKTTNEIKGFTFNPIPNPEELL

  Protein domains


Predicted by InterproScan

(5-69)

  Protein structure



No available structure.



  Reference


[1] Gernot Glöckner et al. (2008) Identification and characterization of a new conjugation/type IVA secretion system (trb/tra) of Legionella pneumophila Corby localized on two mobile genomic islands.. International journal of medical microbiology : IJMM. 298(5-6):411-28. [PMID:17888731]