Detailed information of auxiliary protein

Auxiliary protein


ID   392 GenBank   ABQ56695
Name   traK_Trb-1 experimental UniProt ID   _
Length   117 a.a. PDB ID   _
Note   

  Protein sequence


Download         Length: 117 a.a.        Molecular weight: 13328.57 Da        Isoelectric Point: 10.7747

>ABQ56695.1 traJ protein [Legionella pneumophila str. Corby]
MDDKNKSPSRKHGRHLRVPVLPDEEISIKSHAAQAGLSVAGYLRRIGLGYQIHSAIDKDYILQLSKINAD
MGRLGGLFKLWLTQDRRVAHFDHRKVKALLDRIQTMQAAMFEVVKKL

  Protein domains



No domain identified.


  Protein structure



No available structure.



  Reference


[1] Gernot Glöckner et al. (2008) Identification and characterization of a new conjugation/type IVA secretion system (trb/tra) of Legionella pneumophila Corby localized on two mobile genomic islands.. International journal of medical microbiology : IJMM. 298(5-6):411-28. [PMID:17888731]