Detailed information of auxiliary protein

Auxiliary protein


ID   39 GenBank   CAD24398
Name   TraK_pB4 insolico UniProt ID   Q8RSG8
Length   123 a.a. PDB ID   _
Note   _

  Protein sequence


Download         Length: 123 a.a.        Molecular weight: 13936.01 Da        Isoelectric Point: 8.4443

>CAD24398.1 TraJ protein (plasmid) [uncultured bacterium]
MEADEQPTAKRRQHLRVPVFPEEKELIEANAKRAGVSVARYLRDVGQGYQIKGVMDYEYVRELVRVNGDL
GRLGGLLKLWLTDDPRTARFGDATILALLGRIEATQDEMSRLMKSVVQPRAEP

  Protein domains



No domain identified.


  Protein structure



No available structure.



  Reference


[1] Tauch A et al. (2003) The 79,370-bp conjugative plasmid pB4 consists of an IncP-1beta backbone loaded with a chromate resistance transposon, the strA-strB streptomycin resistance gene pair, the oxacillinase gene bla(NPS-1), and a tripartite antibiotic efflux system of the resistance-nodulation-division family. Mol Genet Genomics. 268(5):570-84. [PMID:12589432]