Detailed information of auxiliary protein

Auxiliary protein

ID   31 GenBank   NP_073213
Name   MobC_pDN1 insolico UniProt ID   Q9EU19
Length   136 a.a. PDB ID   _
Note   _

  Protein sequence


Download         Length: 136 a.a.        Molecular weight: 15085.39 Da        Isoelectric Point: 10.1732

>NP_073213.1 mobilisation protein B (plasmid) [Dichelobacter nodosus]
MSAIDRVRKSRGINELAAEIEPLAQSMATLADEARQRIAEVQQASEEQAASWTSQQQQAMSAWRQAAKDM
RAAAGELAKAGQTARSAARGWTWRLWAGVLIASVMPILALLIASWLWLEPQIIEQQGSIWLIFKLK

  Protein domains


Predicted by InterproScan

Mobilization protein B (Mobilization_B)

(1-136)

  Protein structure


Source ID Structure
AlphaFold DB Q9EU19

  Reference


[1] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]