Detailed information of auxiliary protein

Auxiliary protein

• ID: 301
• GenBank: NP_862456
• Name: TraK_pADP-1
• UniProt ID: Q79BS4
• Length: 132 a.a.
• PDB ID: _
• Note: TraK protein; oriT binding protein

Protein sequence

• Length: 132 a.a.
• Molecular weight: 14621.83 Da
• Isoelectric Point: 9.9884

>NP_862456.1 TraK protein (plasmid) [Pseudomonas sp. ADP]
MPKTYPEELAEWVKGREAKKPRQDKHVVAFLAVKSDVQAALDAGYAMKTIWEHMKETGRLRCRYETFTQH
VKRYIKAAPVASPPPPATPPDSQPKGAKPEPKAAPPASESKSEPPKIGGFTFDATPKKEDLL

Protein domains

Predicted by InterproScan

• Family of unknown function (DUF5338) (DUF5338) (7-74)

Protein structure

• AlphaFold DB: Q79BS4

Reference

[1] Pachulec E et al. (2010) Conjugative Plasmids of Neisseria gonorrhoeae. PLoS One. 5(4):e9962. [PMID:20376355]