Detailed information of auxiliary protein

Auxiliary protein


ID   300 GenBank   NP_862457
Name   TraK_pADP-1 insolico UniProt ID   Q937C0
Length   124 a.a. PDB ID   _
Note   conjugal transfer relaxosome component TraJ

  Protein sequence


Download         Length: 124 a.a.        Molecular weight: 14206.27 Da        Isoelectric Point: 8.5329

>NP_862457.1 TraJ protein (plasmid) [Pseudomonas sp. ADP]
MENDEKEHGRRRRQHLRVPVFPEEKDEIEANAKRAGVSVARYLRDVGQGYQIKGVMDYQHVRELVRVNGD
LGRLGGLLKLWLTDDVRTLQFGEATILALLGRIEATQDEMSRIMKAVVQPRAEP

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB Q937C0

  Reference


[1] Pachulec E et al. (2010) Conjugative Plasmids of Neisseria gonorrhoeae. PLoS One. 5(4):e9962. [PMID:20376355]