Detailed information of auxiliary protein

Auxiliary protein

ID   3 GenBank   CAA38339
Name   TraK_RP4 experimental UniProt ID   P17910
Length   134 a.a. PDB ID   _
Note   TraK oriT binding protein

  Protein sequence


Download         Length: 134 a.a.        Molecular weight: 14716.82 Da        Isoelectric Point: 10.5082

>CAA38339.1 traK (plasmid) [Escherichia coli HB101]
MPKSYTDELAEWVESRAAKKRRRDEAAVAFLAVRADVEAALASGYALVTIWEHMRETGKVKFSYETFRSH
ARRHIKAKPADVPAPQAKAAEPAPAPKTPEPRRPKQGGKAEKPAPAAAPTGFTFNPTPDKKDLL

  Protein domains


Predicted by InterproScan

Family of unknown function (DUF5338) (DUF5338)

(7-74)

  Protein structure


Source ID Structure
AlphaFold DB P17910

  Reference


[1] Grahn AM et al. (2000) Components of the RP4 Conjugative Transfer Apparatus Form an Envelope Structure Bridging Inner and Outer Membranes of Donor Cells: Implications for Related Macromolecule Transport Systems. J Bacteriol. 182(6):1564-74. [PMID:10692361]
[2] Pansegrau W et al. (1990) In vitro assembly of relaxosomes at the transfer origin of plasmid RP4. Proc Natl Acad Sci U S A. 87(17):6555-9. [PMID:2168553]
[3] Pansegrau W et al. (1988) The origin of conjugative IncP plasmid transfer: interaction with plasmid-encoded products and the nucleotide sequence at the relaxation site. Biochim Biophys Acta. 951(2-3):365-74. [PMID:2850014]