Detailed information of auxiliary protein

Auxiliary protein


ID   299 GenBank   NP_862459
Name   TraK_pADP-1 insolico UniProt ID   Q79BS3
Length   130 a.a. PDB ID   _
Note   relaxosome stabilization protein

  Protein sequence


Download         Length: 130 a.a.        Molecular weight: 13936.41 Da        Isoelectric Point: 3.9776

>NP_862459.1 TraH protein (plasmid) [Pseudomonas sp. ADP]
MSEPKDQSIEDELDAALAALDSGPLPTSTLPEPQPSPEQATAGQPPAEATAPTPAFTPPPSTGSPTLDAL
EENRRPKASTVCEHCPNSVWFASPAEVKCYCRVMFLVTWSSKEPNQITHCDGEFLGQEQE

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB Q79BS3

  Reference


[1] Pachulec E et al. (2010) Conjugative Plasmids of Neisseria gonorrhoeae. PLoS One. 5(4):e9962. [PMID:20376355]