Detailed information of auxiliary protein

Auxiliary protein


ID   297 GenBank   YP_001874875
Name   TrwA_R7K experimental UniProt ID   B2G2N8
Length   121 a.a. PDB ID   _
Note   mobilisation protein

  Protein sequence


Download         Length: 121 a.a.        Molecular weight: 13473.38 Da        Isoelectric Point: 5.0435

>YP_001874875.1 mobilisation protein (plasmid) [Providencia rettgeri]
MALGEPIKFRLTPEKHAQYEDEAARLGKPLGTYLRERLEADDAVRDELAALRREVVSLHHVIEDLADTGL
RSDQSGPGPNAVQIETLLLLRAIAGPERMKPVKGELKRLGIEVWTPEGKED

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB B2G2N8

  Reference


[1] Revilla C et al. (2008) Different pathways to acquiring resistance genes illustrated by the recent evolution of IncW plasmids. Antimicrob Agents Chemother. 52(4):1472-80. [PMID:18268088]