Detailed information of auxiliary protein
Auxiliary protein
| ID | 284 | GenBank | CAA31972 |
| Name | TraY_R1 |
UniProt ID | P10512 |
| Length | 75 a.a. | PDB ID | _ |
| Note | oriT_R1, auxiliary protein TraY and TraM are important to the activation of protein secretion through T4SS [PMID:22248924]. | ||
Protein sequence
Download Length: 75 a.a. Molecular weight: 9072.20 Da Isoelectric Point: 10.2071
>CAA31972.1 traY peptide (AA 1-75) (plasmid) [Escherichia coli]
MRRRNARGGISRTVSVYLDEDTNNRLIRAKDRSGRSKTIEVQIRLRDHLKRFPDFYNEEIFREVIEENES
TFKEL
MRRRNARGGISRTVSVYLDEDTNNRLIRAKDRSGRSKTIEVQIRLRDHLKRFPDFYNEEIFREVIEENES
TFKEL
Protein domains
Predicted by InterproScan
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | P10512 |
Reference
[1] Csitkovits VC et al. (2004) Concomitant reconstitution of TraI-catalyzed DNA transesterase and DNA helicase activity in vitro. J Biol Chem. 279(44):45477-84. [PMID:15322083]
[2] Schwab M et al. (1991) The TraM protein of plasmid R1 is a DNA-binding protein. Mol Microbiol. 5(2):439-46. [PMID:2041477]