Detailed information of auxiliary protein
Auxiliary protein
| ID | 283 | GenBank | P07294 |
| Name | TraY_R1  |
UniProt ID | P07294 |
| Length | 127 a.a. | PDB ID | 1DP3 |
| Note | (1) The T4CP TraD_R1 and auxiliary protein TraM_R1 stimulate relaxosomeR1 activity in vitro [PMID:19114496]. (2) oriT_R1, auxiliary protein TraY and TraM are important to the activation of protein secretion through T4SS [PMID:22248924]. |
||
Protein sequence
Download Length: 127 a.a. Molecular weight: Da Isoelectric Point:
>sp|P07294.1|TRAM2_ECOLX RecName: Full=Relaxosome protein TraM
MAKVQAYVSDEIVYKINKIVERRRAEGAKSTDVSFSSISTMLLELGLRVYEAQMERKESAFNQAEFNKVL
LECAVKTQSTVAKILGIESLSPHVSGNPKFEYANMVEDIRDKVSSEMERFFPENDEE
MAKVQAYVSDEIVYKINKIVERRRAEGAKSTDVSFSSISTMLLELGLRVYEAQMERKESAFNQAEFNKVL
LECAVKTQSTVAKILGIESLSPHVSGNPKFEYANMVEDIRDKVSSEMERFFPENDEE
Protein domains
No domain identified.
Protein structure
| Source | ID | Structure |
|---|---|---|
| PDB | 1DP3 | |
| AlphaFold DB | P07294 |
Reference
[1] Csitkovits VC et al. (2004) Concomitant reconstitution of TraI-catalyzed DNA transesterase and DNA helicase activity in vitro. J Biol Chem. 279(44):45477-84. [PMID:15322083]
[2] Schwab M et al. (1991) The TraM protein of plasmid R1 is a DNA-binding protein. Mol Microbiol. 5(2):439-46. [PMID:2041477]