Detailed information of auxiliary protein

Auxiliary protein


ID   27 GenBank   CAA39377
Name   TraM_pSU316 insolico UniProt ID   Q47544
Length   127 a.a. PDB ID   _
Note   _

  Protein sequence


Download         Length: 127 a.a.        Molecular weight: 14577.58 Da        Isoelectric Point: 5.0516

>CAA39377.1 TraM (plasmid) [Escherichia coli]
MAKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQMERKEFAFNQTEFNKLL
LECVVKTQSSVAKILGIESLSPHVSGNPKFEYANMVEDIREKVSSEMERFFPKNDDE

  Protein domains


Predicted by InterproScan

(1-126)

  Protein structure


Source ID Structure
AlphaFold DB Q47544

  Reference


[1] Salazar L et al. (1992) Characterization and nucleotide sequence of the oriT-traM-finP region of the IncFVII plasmid pSU233. Mol Gen Genet . 234(3):442-8. [PMID:1406590]