Detailed information of auxiliary protein

Auxiliary protein

• ID: 268
• GenBank: YP_006965897
• Name: TraK_pIJB1
• UniProt ID: K4JDT7
• Length: 132 a.a.
• PDB ID: _
• Note: TraK conjugative transfer protein,oriT binding protein

Protein sequence

• Length: 132 a.a.
• Molecular weight: 14842.04 Da
• Isoelectric Point: 10.5392

>YP_006965897.1 TraK Conjugative transfer protein, OriT binding protein (plasmid) [Burkholderia cepacia]
MPKSYPEELAEWVKKREATRPRQDKNVVAFLALKSDVQDAIAAGYSLRTIWEHMHEKGKIPYRYETFLKH
VRRHIKGRPPAVVDGQPSTPPDPPRPPAAGKTAAPRPQQPTKSAPAPAGFKFDSQPKKEDLL

Protein domains

Predicted by InterproScan

• Family of unknown function (DUF5338) (DUF5338) (7-74)

Protein structure

• AlphaFold DB: K4JDT7