Detailed information of auxiliary protein
Auxiliary protein
| ID | 253 | GenBank | NP_835374 |
| Name | MobC_pTC-F14  |
UniProt ID | Q840R5 |
| Length | 131 a.a. | PDB ID | _ |
| Note | histone-like mobilization protein | ||
Protein sequence
Download Length: 131 a.a. Molecular weight: 13984.96 Da Isoelectric Point: 10.2555
>NP_835374.1 histone-like mobilization protein (plasmid) [Acidithiobacillus caldus]
MASSKQLYDIDAYAKKARTALENLEKTQQPGEVTGKGGKADVIRAIKSDLEALIKKGYTSKQIADALKHD
DVFGILPKTITEIVAGKKQNKSTVTRKKKSTTPAPTASGQANTAPIPQAGTFTVKPDSEDL
MASSKQLYDIDAYAKKARTALENLEKTQQPGEVTGKGGKADVIRAIKSDLEALIKKGYTSKQIADALKHD
DVFGILPKTITEIVAGKKQNKSTVTRKKKSTTPAPTASGQANTAPIPQAGTFTVKPDSEDL
Protein domains
No domain identified.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q840R5 |
Reference
[1] Rawlings DE (2005) The evolution of pTF-FC2 and pTC-F14, two related plasmids of the IncQ-family. Plasmid. 53(2):137-47. [PMID:15737401]
[2] van Zyl LJ et al. (2003) Analysis of the mobilization region of the broad-host-range IncQ-like plasmid pTC-F14 and its ability to interact with a related plasmid, pTF-FC2. J Bacteriol. 185(20):6104-11. [PMID:14526022]