Detailed information of auxiliary protein
Auxiliary protein
| ID | 252 | GenBank | NP_835375 |
| Name | MobC_pTC-F14  |
UniProt ID | Q840R4 |
| Length | 103 a.a. | PDB ID | _ |
| Note | oriT recognition-like protein | ||
Protein sequence
Download Length: 103 a.a. Molecular weight: 11210.91 Da Isoelectric Point: 9.7756
>NP_835375.1 oriT recognition-like protein (plasmid) [Acidithiobacillus caldus]
MPFTVQGLEPLDAVVNVRLTASEKARLREDADLAGLSVSELVRRRYFGRPIVAHADAVLLKELRRIGGLL
KHVHNESGGAYSQQTAAVLVTLKAAIEGLSHDR
MPFTVQGLEPLDAVVNVRLTASEKARLREDADLAGLSVSELVRRRYFGRPIVAHADAVLLKELRRIGGLL
KHVHNESGGAYSQQTAAVLVTLKAAIEGLSHDR
Protein domains
Predicted by InterproScan
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q840R4 |
Reference
[1] Rawlings DE (2005) The evolution of pTF-FC2 and pTC-F14, two related plasmids of the IncQ-family. Plasmid. 53(2):137-47. [PMID:15737401]
[2] van Zyl LJ et al. (2003) Analysis of the mobilization region of the broad-host-range IncQ-like plasmid pTC-F14 and its ability to interact with a related plasmid, pTF-FC2. J Bacteriol. 185(20):6104-11. [PMID:14526022]