Detailed information of auxiliary protein

Auxiliary protein


ID   25 GenBank   CAD97518
Name   TraK_pB10 insolico UniProt ID   Q7AS79
Length   132 a.a. PDB ID   _
Note   involved in conjugative DNA transfer

  Protein sequence


Download         Length: 132 a.a.        Molecular weight: 14621.83 Da        Isoelectric Point: 9.9884

>CAD97518.1 oriT binding protein (plasmid) [uncultured bacterium]
MPKTYPEELAEWVKGREAKKPRQDKHVVAFLAVKSDVQAALDAGYAMKTIWEHMKETGRLRCRYETFTQH
VKRYIKAAPVASPPPPATPPDSQPKGAKPEPKAAPPASESKSEPPKIGGFTFDATPKKEDLL

  Protein domains


Predicted by InterproScan

(7-74)

  Protein structure


Source ID Structure
AlphaFold DB Q7AS79

  Reference


[1] Schlüter A et al. (2003) The 64 508 bp IncP-1beta antibiotic multiresistance plasmid pB10 isolated from a waste-water treatment plant provides evidence for recombination between members of different branches of the IncP-1beta group. Microbiology. 149(Pt 11):3139-53. [PMID:14600226]