Detailed information of auxiliary protein

Auxiliary protein


ID   247 GenBank   AAA27390
Name   MobC_pTF-FC2 insolico UniProt ID   P22899
Length   118 a.a. PDB ID   _
Note   relaxosome component

  Protein sequence


Download         Length: 118 a.a.        Molecular weight: 12955.87 Da        Isoelectric Point: 10.2120

>AAA27390.1 ORF1 (plasmid) [Plasmid pTF-FC2]
MKYTTEQLEAIASKLRDMPQVEKKKQEHSKQEAVRVLSKEIAALQKRGYTLDQISETLRGEGLSIATPTL
KSYLQRAKPTKKAPVQAPGDTPPPAPAVKKPADTSKATFTPKPDSDDI

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB P22899

  Reference


[1] van Zyl LJ et al. (2003) Analysis of the mobilization region of the broad-host-range IncQ-like plasmid pTC-F14 and its ability to interact with a related plasmid, pTF-FC2. J Bacteriol. 185(20):6104-11. [PMID:14526022]