Detailed information of auxiliary protein

Auxiliary protein


ID   246 GenBank   B43256
Name   MobC_pTF-FC2 insolico UniProt ID   _
Length   106 a.a. PDB ID   _
Note   relaxosome component

  Protein sequence


Download         Length: 106 a.a.        Molecular weight: 11618.45 Da        Isoelectric Point: 9.9109

>pir||B43256 mobilization protein mobB - Thiobacillus ferrooxidans plasmid pTF-FC2
MPFETQGPEPLDAVINVRLTAAEKARLKEDADLAGLSMSELVRRRYFGRPIIASADAVMLKELRRIGGLL
KHIHNESGGVYSKDTAGALVVLKAYIGKLSRDRQEG

  Protein domains



No domain identified.


  Protein structure



No available structure.



  Reference


[1] van Zyl LJ et al. (2003) Analysis of the mobilization region of the broad-host-range IncQ-like plasmid pTC-F14 and its ability to interact with a related plasmid, pTF-FC2. J Bacteriol. 185(20):6104-11. [PMID:14526022]