Detailed information of auxiliary protein

Auxiliary protein


ID   245 GenBank   NP_065330
Name   NikA_R721  insolico UniProt ID   Q9F554
Length   113 a.a. PDB ID   _
Note   relaxosome component

  Protein sequence


Download         Length: 113 a.a.        Molecular weight: 13147.21 Da        Isoelectric Point: 10.4689

>NP_065330.1 relaxosome component (plasmid) [Escherichia coli]
MKKKTNKNVHVTFRLTEEEYAPFDRAIKELNISKSEFFRLLTIGKINTYASDKRNIPEYKRCLSQLSWAG
NNINQIAHRLNSDHLKGIISESLYKKVLNGLIGIRDRLQEIAK

  Protein domains


Predicted by InterproScan

(63-85)

  Protein structure


Source ID Structure
AlphaFold DB Q9F554

  Reference


[1] Varsaki A et al. (2009) Analysis of ColE1 MbeC unveils an extended ribbon-helix-helix family of nicking accessory proteins. J Bacteriol. 191(5):1446-55. [PMID:19114496]