Detailed information of auxiliary protein
Auxiliary protein
| ID | 243 | GenBank | NP_044275 |
| Name | TraK_R751 |
UniProt ID | _ |
| Length | 124 a.a. | PDB ID | _ |
| Note | _ | ||
Protein sequence
Download Length: 124 a.a. Molecular weight: 14206.27 Da Isoelectric Point: 8.5329
MENDEKEHGRRRRQHLRVPVFPEEKDEIEANAKRAGVSVARYLRDVGQGYQIKGVMDYQHVRELVRVNGD
LGRLGGLLKLWLTDDVRTLQFGEATILALLGRIEATQDEMSRIMKAVVQPRAEP
Protein domains
No domain identified.
Protein structure
No available structure.
Reference
[1] Waters VL et al. (1991) Sequence identity in the nick regions of IncP plasmid transfer origins and T-DNA borders of Agrobacterium Ti plasmids. Proc Natl Acad Sci U S A. 88(4):1456-60. [PMID:1996345]
[2] Fürste JP et al. (1989) Conjugative transfer of promiscuous IncP plasmids: interaction of plasmid-encoded products with the transfer origin. Proc Natl Acad Sci U S A. 86(6):1771-5. [PMID:2538813]
[3] Pansegrau W et al. (1988) The origin of conjugative IncP plasmid transfer: interaction with plasmid-encoded products and the nucleotide sequence at the relaxation site. Biochim Biophys Acta. 951(2-3):365-74. [PMID:2850014]