Detailed information of auxiliary protein
Auxiliary protein
| ID | 242 | GenBank | NP_044273 |
| Name | TraK_R751  |
UniProt ID | _ |
| Length | 130 a.a. | PDB ID | _ |
| Note | relaxosome stabilisation | ||
Protein sequence
Download Length: 130 a.a. Molecular weight: 13936.41 Da Isoelectric Point: 3.9776
>NP_044273.1 hypothetical protein R751p64 [[Enterobacter] aerogenes]
MSEPKDQSIEDELDAALAALDSGPLPTSTLPEPQPSPEQATAGQPPAEATAPTPAFTPPPSTGSPTLDAL
EENRRPKASTVCEHCPNSVWFASPAEVKCYCRVMFLVTWSSKEPNQITHCDGEFLGQEQE
MSEPKDQSIEDELDAALAALDSGPLPTSTLPEPQPSPEQATAGQPPAEATAPTPAFTPPPSTGSPTLDAL
EENRRPKASTVCEHCPNSVWFASPAEVKCYCRVMFLVTWSSKEPNQITHCDGEFLGQEQE
Protein domains
No domain identified.
Protein structure
No available structure.
Reference
[1] Waters VL et al. (1991) Sequence identity in the nick regions of IncP plasmid transfer origins and T-DNA borders of Agrobacterium Ti plasmids. Proc Natl Acad Sci U S A. 88(4):1456-60. [PMID:1996345]
[2] Pansegrau W et al. (1988) The origin of conjugative IncP plasmid transfer: interaction with plasmid-encoded products and the nucleotide sequence at the relaxation site. Biochim Biophys Acta. 951(2-3):365-74. [PMID:2850014]