Detailed information of auxiliary protein

Auxiliary protein

• ID: 238
• GenBank: BAA08131
• Name: MobC_pEC3
• UniProt ID: Q47386
• Length: 161 a.a.
• PDB ID: _
• Note: MbeB-like, N-term conserved region; pfam04837

Protein sequence

• Length: 161 a.a.
• Molecular weight: 18027.63 Da
• Isoelectric Point: 9.1972

>BAA08131.1 mobB (plasmid) [Pectobacterium carotovorum]
MNSLLTLAKDLEQKSKAHEQSTGEMLKAAFSEHEKSVRAELSESEKRISAAILDHDRKLSSVMSQRTKGM
LRMVSQTWLTIVLVSVLLIASSAGILWWQGQQILDNYTTIREQKSTQAMLSERNSGVQLTTCGEQRRRCV
RVNPEAGTFGEDSSWMILAGK

Protein domains

Predicted by InterproScan

• MbeB-like, N-term conserved region (MbeB_N) (1-52)

Protein structure

• AlphaFold DB: Q47386

Reference

[1] Nomura N et al. (1996) Genetic organization of a DNA-processing region required for mobilization of a non-self-transmissible plasmid, pEC3, isolated from Erwinia carotovora subsp. carotovora. Gene. 170(1):57-62. [PMID:8621089]