Detailed information of auxiliary protein

Auxiliary protein


ID   237 GenBank   ABZ82007
Name   TrwA_pSa insolico UniProt ID   Q04229
Length   121 a.a. PDB ID   _
Note   _

  Protein sequence


Download         Length: 121 a.a.        Molecular weight: 13400.32 Da        Isoelectric Point: 4.8464

>ABZ82007.1 TrwA (plasmid) [Escherichia coli]
MALGDPIQVRLSPEKQALLEDEAARKGKRLATYLRELLESENDLQGELAALRREVVSLHHVIEDLADTGL
RSDQSGPGQNAVQIETLLLLRAIAGPERMKPVKGELKRLGIEVWTPEGKED

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB Q04229

  Reference


[1] Revilla C et al. (2008) Different pathways to acquiring resistance genes illustrated by the recent evolution of IncW plasmids. Antimicrob Agents Chemother. 52(4):1472-80. [PMID:18268088]