Detailed information of auxiliary protein

Auxiliary protein


ID   23 GenBank   CAD97515
Name   TraK_pB10 insolico UniProt ID   Q7AS80
Length   130 a.a. PDB ID   _
Note   relaxosome stabilisation protein

  Protein sequence


Download         Length: 130 a.a.        Molecular weight: 13936.41 Da        Isoelectric Point: 3.9776

>CAD97515.1 relaxosome stabilisation protein (plasmid) [uncultured bacterium]
MSEPKDQSIEDELDAALAALDSGPLPTSTLPEPQPSPEQATAGQPPAEATAPTPAFTPPPSTGSPTLDAL
EENRRPKASTVCEHCPNSVWFASPAEVKCYCRVMFLVTWSSKEPNQITHCDGEFLGQEQE

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB Q7AS80

  Reference


[1] Schlüter A et al. (2003) The 64 508 bp IncP-1beta antibiotic multiresistance plasmid pB10 isolated from a waste-water treatment plant provides evidence for recombination between members of different branches of the IncP-1beta group. Microbiology. 149(Pt 11):3139-53. [PMID:14600226]