Detailed information of auxiliary protein

Auxiliary protein


ID   223 GenBank   CAK02689
Name   TraK_pKJK5  insolico UniProt ID   H2EPP6
Length   129 a.a. PDB ID   _
Note   _

  Protein sequence


Download         Length: 129 a.a.        Molecular weight: 14231.17 Da        Isoelectric Point: 10.3151

>CAK02689.1 TraK protein (plasmid) [uncultured bacterium]
MAKSLSERIAQRVSAKQPSRTGKNRASFLAVRDDVRKALDDGWPVKVIWDTLRDEGKIEFGYDAFIGYVN
RLIRNAETSPAKPPADQVKADKPAPKAKAKTDAPQEPKAEAPSIGGFNFNPKPNKEDLL

  Protein domains


Predicted by InterproScan

(3-72)

  Protein structure


Source ID Structure
AlphaFold DB H2EPP6

  Reference


[1] Bahl MI et al. (2007) The multiple antibiotic resistance IncP-1 plasmid pKJK5 isolated from a soil environment is phylogenetically divergent from members of the previously established alpha, beta and delta sub-groups. Plasmid. 58(1):31-43. [PMID:17306874]