Detailed information of auxiliary protein

Auxiliary protein


ID   222 GenBank   CAK02688
Name   TraK_pKJK5  insolico UniProt ID   H2EQ19
Length   124 a.a. PDB ID   _
Note   conjugal transfer relaxosome component TraJ; oriT binding protein

  Protein sequence


Download         Length: 124 a.a.        Molecular weight: 14196.30 Da        Isoelectric Point: 10.1233

>CAK02688.1 oriT binding protein (plasmid) [uncultured bacterium]
MEKDEKQTGRKRRHHLRVPVFPDEKEEIERQARQAGLSVARYLREVGQGYEIKGITDYERVRELARINGD
LGRLGGLLKLWLTDDARTAKFGEATILALLGRIEATQDEMGRVMKAVVRPRAEP

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB H2EQ19

  Reference


[1] Bahl MI et al. (2007) The multiple antibiotic resistance IncP-1 plasmid pKJK5 isolated from a soil environment is phylogenetically divergent from members of the previously established alpha, beta and delta sub-groups. Plasmid. 58(1):31-43. [PMID:17306874]