Detailed information of auxiliary protein

Auxiliary protein


ID   22 GenBank   NP_052946
Name   TraY_R100 experimental UniProt ID   Q7AK74
Length   75 a.a. PDB ID   _
Note   _

  Protein sequence


Download         Length: 75 a.a.        Molecular weight: 8541.74 Da        Isoelectric Point: 8.6796

>NP_052946.1 component of oriT-specific nickase (plasmid) [Shigella flexneri 2b]
MSRNIIRPAPGNKVLLVLDDATNHKLLGARERSGRTKTNEVLVRLRDHLNRFPDFYNLDAIKEGAEETDS
IIKDL

  Protein domains


Predicted by InterproScan

(14-60)

  Protein structure


Source ID Structure
AlphaFold DB Q7AK74

  Reference


[1] Joyce J W Wong et al. (2012) Relaxosome function and conjugation regulation in F-like plasmids - a structural biology perspective. Molecular microbiology. 85(4):602-17. [PMID:22788760]