Detailed information of auxiliary protein

Auxiliary protein

• ID: 216
• GenBank: NP_904302
• Name: TraK_pUO1
• UniProt ID: Q76M00
• Length: 132 a.a.
• PDB ID: _
• Note: _

Protein sequence

• Length: 132 a.a.
• Molecular weight: 14621.83 Da
• Isoelectric Point: 9.9884

>NP_904302.1 hypothetical protein pUO1_53 (plasmid) [Delftia acidovorans]
MPKTYPEELAEWVKGREAKKPRQDKHVVAFLAVKSDVQAALDAGYAMKTIWEHMKETGRLRCRYETFTQH
VKRYIKAAPVASPPPPATPPDSQPKGAKPEPKAAPPASESKSEPPKIGGFTFDATPKKEDLL

Protein domains

Predicted by InterproScan

• Family of unknown function (DUF5338) (DUF5338) (7-74)

Protein structure

• AlphaFold DB: Q76M00