Detailed information of auxiliary protein

Auxiliary protein

• ID: 2152
• GenBank: WP_011205820
• Name: WP_011205820_pRK2013
• UniProt ID: A0A2R4AHM2
• Length: 134 a.a.
• PDB ID: _
• Note: Predicted by oriTfinder 2.0

Protein sequence

• Length: 134 a.a.
• Molecular weight: 14716.82 Da
• Isoelectric Point: 10.5082

>WP_011205820.1 MULTISPECIES: TraK family protein [Pseudomonadota]
MPKSYTDELAEWVESRAAKKRRRDEAAVAFLAVRADVEAALASGYALVTIWEHMRETGKVKFSYETFRSH
ARRHIKAKPADVPAPQAKAAEPAPAPKTPEPRRPKQGGKAEKPAPAAAPTGFTFNPTPDKKDLL

Protein domains

Predicted by InterproScan

• Family of unknown function (DUF5338) (DUF5338) (7-74)

Protein structure

• AlphaFold DB: A0A2R4AHM2