Detailed information of auxiliary protein

Auxiliary protein


ID   20 GenBank   NP_511203
Name   TraK_R46 insolico UniProt ID   Q79SD6
Length   138 a.a. PDB ID   _
Note   _

  Protein sequence


Download         Length: 138 a.a.        Molecular weight: 15332.60 Da        Isoelectric Point: 5.9670

>NP_511203.1 TraK (plasmid) [Salmonella enterica subsp. enterica serovar Typhimurium]
MPIITAKVSDELLAYIDLVSGGNRSDYLRRCLEAGPGDRESGLKIVADRLSDVNRKLDYLFDRASDADFG
PLRDELKAITETLSGVKFPPAGQMMLHESLAIETLILLRSIAEPGKTKAAKAEVERNGYKVWEPKKER

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB Q79SD6

  Reference


[1] Paterson ES et al. (1999) Genetic analysis of the mobilization and leading regions of the IncN plasmids pKM101 and pCU1. J Bacteriol. 181(8):2572-83. [PMID:10198024]