Detailed information of auxiliary protein

Auxiliary protein


ID   164 GenBank   YP_001911164
Name   TrwA_pIE321 experimental UniProt ID   A7KZU3
Length   120 a.a. PDB ID   _
Note   relaxosome accessory protein

  Protein sequence


Download         Length: 120 a.a.        Molecular weight: 13242.20 Da        Isoelectric Point: 4.8464

>YP_001911164.1 TrwA (plasmid) [Salmonella enterica subsp. enterica serovar Dublin]
MALGDPIQVRLSPEKQALLEDEAARKGKRLATYLRELLEGENDLQGELAAIRREVASLHHMIEDLADAGP
RGQAEPGTNPVQIETLLLLRAIAGPERMKPVKGEMKRLGIDVWTPEGKED

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB A7KZU3

  Reference


[1] Revilla C et al. (2008) Different pathways to acquiring resistance genes illustrated by the recent evolution of IncW plasmids. Antimicrob Agents Chemother. 52(4):1472-80. [PMID:18268088]