Detailed information of auxiliary protein

Auxiliary protein


ID   159 GenBank   CAJ43357
Name   TraH_QKH54 insolico UniProt ID   Q1H9W8
Length   139 a.a. PDB ID   _
Note   TraH relaxosome stabilising protein

  Protein sequence


Download         Length: 139 a.a.        Molecular weight: 15447.10 Da        Isoelectric Point: 3.6758

>CAJ43357.1 TraH relaxosome stabilising protein (plasmid) [uncultured bacterium]
MSEELTEDELLAQALASMDSTPPGGDEESGPEEPPEPGEVLEFGEAPPEPSFLDELEQPPVDESPFAPLE
EPQSLVLQELDESRRPKARTVCERCPNSVWFSSPKEVKCYCRVMFLVSWSTKEPNQITGCDGMFLGQEE

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB Q1H9W8

  Reference


[1] Pachulec E et al. (2010) Conjugative Plasmids of Neisseria gonorrhoeae. PLoS One. 5(4):e9962. [PMID:20376355]
[2] Haines AS et al. (2006) Plasmids from freshwater environments capable of IncQ retrotransfer are diverse and include pQKH54, a new IncP-1 subgroup archetype. Microbiology. 152(Pt 9):2689-701. [PMID:16946264]