Detailed information of auxiliary protein

Auxiliary protein

• ID: 158
• GenBank: CAJ43360
• Name: TraH_QKH54
• UniProt ID: Q1H9W5
• Length: 142 a.a.
• PDB ID: _
• Note: TraK oriT-binding protein

Protein sequence

• Length: 142 a.a.
• Molecular weight: 15552.88 Da
• Isoelectric Point: 10.7786

>CAJ43360.1 TraK oriT-binding protein (plasmid) [uncultured bacterium]
MAKNGKSLSERIAERAQKKKQPGRAGKNRAAFLAVRDEVRQALDDGWPVKDVWETLYAEGAIAFRYDAFI
GYVKKLIRQPPTVATSIPVVQEAPARPATPAKTPTAKPKPTPKPATRDPVVTKPSTPGSFSFDSTPRKED
LL

Protein domains

Predicted by InterproScan

• Family of unknown function (DUF5338) (DUF5338) (6-75)

Protein structure

• AlphaFold DB: Q1H9W5

Reference

[1] Pachulec E et al. (2010) Conjugative Plasmids of Neisseria gonorrhoeae. PLoS One. 5(4):e9962. [PMID:20376355]
[2] Haines AS et al. (2006) Plasmids from freshwater environments capable of IncQ retrotransfer are diverse and include pQKH54, a new IncP-1 subgroup archetype. Microbiology. 152(Pt 9):2689-701. [PMID:16946264]