Detailed information of auxiliary protein

Auxiliary protein

• ID: 1558
• GenBank: WP_072648817
• Name: WP_072648817_pTB-nb2
• UniProt ID: A0A1M0W3C4
• Length: 110 a.a.
• PDB ID: _
• Note: Predicted by oriTfinder 2.0

Protein sequence

• Length: 110 a.a.
• Molecular weight: 12596.65 Da
• Isoelectric Point: 10.6096

>WP_072648817.1 plasmid mobilization protein MobA [Escherichia coli]
MSEKKNRSGSEKRQKNVLIAVRFSPEEADIVKEKAEKNGLTVSTLIRKTVLGKQINARIDEDFLKELMRL
GRLQKHLFVEGKRTGDKEYAEVLVAITELANTLRRDLMGR

Protein domains

Predicted by InterproScan

• Family of unknown function (DUF6290) (DUF6290) (19-66)

Protein structure

• AlphaFold DB: A0A1M0W3C4