Detailed information of auxiliary protein
Auxiliary protein
| ID | 13 | GenBank | YP_009182121 |
| Name | TrwA_R388  |
UniProt ID | Q04229 |
| Length | 121 a.a. | PDB ID | _ |
| Note | (1) The T4CP TrwB_R388 ATPase activity is stimulated by ssDNA, dsDNA and the C-terminal Region of auxiliary protein TrwA_R388 [PMID:17599913]. (2) GTAGTG in oriT_R388 is the specific binding sequence of the auxiliary protein TrwA_R388 [PMID:15450172]. (3) The auxiliary protein TrwA_R388 binds specifically to two regions (region A and region B) with different affinities: Region A (high affinity) : 71-108 bp and Region B (low affinity) : 125-165 bp [PMID:9236121]. (4) The auxiliary protein TrwA_R388 perform two biochemical activities: binding to oriT resulted in transcriptional repression of the trwABC operon and enhanced the relaxation activity of relaxase TrwC_R388 in vitro [PMID:9236121]. |
||
Protein sequence
Download Length: 121 a.a. Molecular weight: 13400.32 Da Isoelectric Point: 4.8464
MALGDPIQVRLSPEKQALLEDEAARKGKRLATYLRELLESENDLQGELAALRREVVSLHHVIEDLADTGL
RSDQSGPGQNAVQIETLLLLRAIAGPERMKPVKGELKRLGIEVWTPEGKED
Protein domains
No domain identified.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q04229 |
Reference
[1] de la Cruz F et al. (2010) Conjugative DNA metabolism in Gram-negative bacteria. FEMS Microbiol Rev. 34(1):18-40. [PMID:19919603]
[2] Revilla C et al. (2008) Different pathways to acquiring resistance genes illustrated by the recent evolution of IncW plasmids. Antimicrob Agents Chemother. 52(4):1472-80. [PMID:18268088]
[3] Fernández-López R et al. (2006) Dynamics of the IncW genetic backbone imply general trends in conjugative plasmid evolution. FEMS Microbiol Rev. 30(6):942-66. [PMID:17026718]
[4] Llosa M et al. (1994) Genetic organization of the conjugal DNA processing region of the IncW plasmid R388. J Mol Biol. 235(2):448-64. [PMID:8289274]