Detailed information of auxiliary protein
Auxiliary protein
| ID | 1 | GenBank | CAA38338 |
| Name | TraK_RP4  |
UniProt ID | P17909 |
| Length | 123 a.a. | PDB ID | _ |
| Note | to specifically bind to the nick site-proximal arm of the 19-bp inverted repeat sequence | ||
Protein sequence
Download Length: 123 a.a. Molecular weight: 13463.65 Da Isoelectric Point: 7.9867
MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAVGQGYKITGVVDYEHVRELARINGDL
GRLGGLLKLWLTDDPRTARFGDATILALLAKIEEKQDELGKVMMGVVRPRAEP
Protein domains
No domain identified.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | P17909 |
Reference
[1] Grahn AM et al. (2000) Components of the RP4 Conjugative Transfer Apparatus Form an Envelope Structure Bridging Inner and Outer Membranes of Donor Cells: Implications for Related Macromolecule Transport Systems. J Bacteriol. 182(6):1564-74. [PMID:10692361]
[2] Pansegrau W et al. (1990) In vitro assembly of relaxosomes at the transfer origin of plasmid RP4. Proc Natl Acad Sci U S A. 87(17):6555-9. [PMID:2168553]
[3] Fürste JP et al. (1989) Conjugative transfer of promiscuous IncP plasmids: interaction of plasmid-encoded products with the transfer origin. Proc Natl Acad Sci U S A. 86(6):1771-5. [PMID:2538813]
[4] Pansegrau W et al. (1988) The origin of conjugative IncP plasmid transfer: interaction with plasmid-encoded products and the nucleotide sequence at the relaxation site. Biochim Biophys Acta. 951(2-3):365-74. [PMID:2850014]