ID | 86 |
Name | MobA_pIE1120 |
GenBank accession number | AAC72343 |
Family | Other |
Length | 40 aa |
UniProt ID | O88171 |
PDB ID | _ |
Pfam | |
Note | Conjugal transfer relaxase TraA; partial sequence |
Protein sequence [Download] | MAIYHLTAKTGSRSGGQSARAKADYIQREGKYARDMDEVL |
[1] Smalla K et al (2000) Exogenous isolation of antibiotic resistance plasmids from piggery manure slurries reveals a high prevalence and diversity of IncQ-like plasmids. Appl Environ Microbiol. 66(11):4854-62. [PMID:11055935] |
# | ID | Name | GenBank | Length | Note |
1 | 125 | MobC_pIE1120 | AAC72342 | 94 aa | mobilization protein MobC |