![]() | 86 |
![]() | MobA_pIE1120 ![]() |
![]() | AAC72343 |
![]() | Other |
![]() | 40 aa |
![]() | O88171 |
![]() | _ |
![]() | |
![]() | Conjugal transfer relaxase TraA; partial sequence |
![]() | MAIYHLTAKTGSRSGGQSARAKADYIQREGKYARDMDEVL |
[1] Smalla K et al (2000) Exogenous isolation of antibiotic resistance plasmids from piggery manure slurries reveals a high prevalence and diversity of IncQ-like plasmids. Appl Environ Microbiol. 66(11):4854-62. [PMID:11055935] |
# | ID | Name | GenBank | Length | Note |
1 | 125 | MobC_pIE1120 ![]() | AAC72342 | 94 aa | mobilization protein MobC |