![]() | 200 |
![]() | Orf57_pAD1 ![]() |
![]() | AAL59457 |
![]() | MOBC |
![]() | 216 aa |
![]() | Q8VT37 |
![]() | _ |
![]() | Replic_Relax [PF13814.5], Evalue: 4.50E-08, Aligned region: 1..160 |
![]() | Replication-relaxation; pfam13814 |
![]() | MAKKSSVYGNLKKLKEKNLVECSQIGSTKFYYLTKEGHNYIGGYYTLPKVPEYNLQHHLQ INDYLIKMLELCNNHPHLKAVVSERRKVYEVKDEKKNQKGVKYFVPDFIFMFLDSIGREV EWQFEIELTLKTKRRYSQGVFPKYIKHLKNYEDARLIYVTPSSIIKEELDMFKEYFIDKE GDEYKEVFDRLHVFSAEEFESELKRLLEKDKFINWE |
[1] Francia MV et al (2001) Completion of the nucleotide sequence of the Enterococcus faecalis conjugative virulence plasmid pAD1 and identification of a second transfer origin. Plasmid. 46(2):117-27. [PMID:11591137] |
[2] Francia MV et al (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531] |
[3] Francia MV et al (2002) Transfer origins in the conjugative Enterococcus faecalis plasmids pAD1 and pAM373: identification of the pAD1 nic site, a specific relaxase and a possible TraG-like protein. Mol Microbiol. 45(2):375-95. [PMID:12123451] |
# | ID | Name | GenBank | Length | Note |
1 | 281 | _ ![]() |