ID | 244 |
Name | CTn3-Orf20_Tn5397 |
GenBank accession number | CAJ67329 |
Family | MOBT |
Length | 402 aa |
UniProt ID | Q188U0 |
PDB ID | _ |
Pfam | Rep_trans [PF02486.18], Evalue: 6.80E-69, Aligned region: 169..374 HTH_3 [PF01381.21], Evalue: 3.90E-09, Aligned region: 16..65 HTH_31 [PF13560.5], Evalue: 1.60E-06, Aligned region: 13..70 |
Note | _ |
Protein sequence [Download] | MIGGISLNEQTWVQHLKEKRLSYGLSQNRLAIATGITRQYLSDIETGKVKPSDELQLALL ETLERFNPDAPLEMLFDYVRIRFPTTDVQHVVEDVLRLKLSYMLHEDYGFYSYTEHYALG NIFVLCSHELDKGVLVELKGRGCRQFESYLLAQQRSWYEFFMDALVASGVMKRLDLAIND KTGILNIPILTEKCRQEECISVFRSFKSYRSGELVRKDEKECMGNTLYIGSLQSEVYFCI YEKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAVRDLLAYDNPEHTAFKIINRYIRF VDKDDSKARSDWKLNEEWAWFIGNNRERLKLTTKPEPYSFQRTLNWLSHQVAPTLKVAIT LDEINQTQVVKDILDHAKLTDRHKQILKQQSVKEQDVITNKK |
# | ID | Name | GenBank | Length | Note |
1 | 333 | _ |
ID | 244 |
Name | CTn3-Orf21_Tn5397 |
SecReT4 accesion number | _ |
GenBank accession number | CAJ67327 |
Family | TrwB/TraD |
Length | 461 |
UniProt ID | Q188U2 |
PDB ID | _ |
Pfam | FtsK_SpoIIIE [PF01580.17], Evalue: 3.70E-06, Aligned region: 208..314 DUF87 [PF01935.16], Evalue: 6.10E-06, Aligned region: 206..352 |
Note | putative cell-division FtsK/SpoIIIE-family protein Tn5397, CTn3-Orf21 |
Protein sequence [Download] |
ID | 35 |
Element type | _ |
ICE description | Tn5397 |
ICEberg accesion number | 103 |
GenBank accession number | AM180355.1 |
Family | Tn916 |
Genome size | 20657 bp |
Coordinate of oriT [+/-] | 587811..588025 [+] |
Drug resistance | tetracycline resistance |
Heavy-metal resistance | _ |
Virulence factor | _ |
Xenobiotic degradation | _ |
Host bacterium [NCBI Taxonomy ID] | Clostridium difficile 630 [272563] |
[1] Sebaihia M et al (2006) The multidrug-resistant human pathogen Clostridium difficile has a highly mobile, mosaic genome. Nat Genet. 38(7):779-86. [PMID:16804543] |
[2] Roberts AP et al (2001) Comparison of Tn5397 from Clostridium difficile, Tn916 from Enterococcus faecalis and the CW459tet(M) element from Clostridium perfringens shows that they have similar conjugation regions but different insertion and excision modules. Microbiology. 147(Pt 5):1243-51. [PMID:11320127] |
[3] Roberts AP et al (1999) Transfer of a conjugative transposon, Tn5397 in a model oral biofilm. FEMS Microbiol Lett. 177(1):63-6. [PMID:10436923] |