[1] Vedantam G et al (2006) Bacteroides fragilis mobilizable transposon Tn5520 requires a 71 base pair origin of transfer sequence and a single mobilization protein for relaxosome formation during conjugation. Mol Microbiol. 59(1):288-300. [PMID:16359335] |
[2] Hecht DW et al (1989) Tn4399, a conjugal mobilizing transposon of Bacteroides fragilis. J Bacteriol. 171(7):3603-8. [PMID:2544548] |
[3] Murphy CG et al (1995) Requirements for strand- and site-specific cleavage within the oriT region of Tn4399, a mobilizing transposon from Bacteroides fragilis. J Bacteriol. 177(11):3158-65. [PMID:7768814] |
![]() | 223 |
![]() | MocA_Tn4399 ![]() |
![]() | AAA98401 |
![]() | MOBP |
![]() | 318 aa |
![]() | Q56424 |
![]() | _ |
![]() | Relaxase [PF03432.13], Evalue: 7.90E-54, Aligned region: 7..242 |
![]() | relaxase |
![]() | MIGKQTKGTSFSGCVCYVLREDKSKLLEAVGVEGTPEQMAEQFELQTLLNDKVKNTVGHT SLNFSPEDGERLKTDDALMLQIAHDYMAKMGIENTQYIVARHTDREHPHCHIVFNRVDND GKTISDKNDFYRNEKVCKMLTAKYRLHFANGKDNIKEERLRPYDKAKHEVYKALKGELPH ARSWNELKEALSERDIELKFKVSRTTKEVQGVKFEYGGISFSGSKVSREFSYMNIDYRLR RNAFEDDFNHRQAAIREPGEEAVQTVSQNRSKDSVGNGLGLFSGIGSSFDVADAEANQEM AEILRKKKKAKRKRGMRL |
[1] Murphy CG et al (1995) Requirements for strand- and site-specific cleavage within the oriT region of Tn4399, a mobilizing transposon from Bacteroides fragilis. J Bacteriol. 177(11):3158-65. [PMID:7768814] |
# | ID | Name | GenBank | Length | Note |
1 | 311 | MocB_Tn4399 ![]() | AAA98400 | 143 aa | Bacterial mobilisation protein (MobC) |
![]() | 14 |
![]() ![]() | ICE (Conjugative transposon) |
![]() | Tn4399 |
![]() | _ |
![]() | L20975.1 |
![]() | _ |
![]() | 9.6 kb |
![]() | 991..1189 [+] |
![]() | _ |
![]() | _ |
![]() | _ |
![]() | _ |
![]() | Bacteroides fragilis TMP230 [817] |
[1] Hecht DW et al (1989) Characterization of the termini and transposition products of Tn4399, a conjugal mobilizing transposon of Bacteroides fragilis. Proc Natl Acad Sci U S A. 86(14):5340-4. [PMID:2546154] |