[1] Rocco JM et al (2006) The integrase of the conjugative transposon Tn916 directs strand- and sequence-specific cleavage of the origin of conjugal transfer, oriT, by the endonuclease Orf20. J Bacteriol. 188(6):2207-13. [PMID:16513750] |
[2] Jaworski DD et al (1995) A functional origin of transfer (oriT) on the conjugative transposon Tn916. J Bacteriol. 177(22):6644-51. [PMID:7592445] |
[3] Roberts AP et al (2001) Comparison of Tn5397 from Clostridium difficile, Tn916 from Enterococcus faecalis and the CW459tet(M) element from Clostridium perfringens shows that they have similar conjugation regions but different insertion and excision modules. Microbiology. 147(Pt 5):1243-51. [PMID:11320127] |
[4] Roberts AP et al (2009) A modular master on the move: the Tn916 family of mobile genetic elements. Trends Microbiol. 17(6):251-8. [PMID:19464182] |
![]() | 215 |
![]() | Orf20_Tn916 ![]() |
![]() | AAB60013 |
![]() | MOBT |
![]() | 329 aa |
![]() | Q47728 |
![]() | _ |
![]() | Rep_trans [PF02486.18], Evalue: 1.80E-69, Aligned region: 96..301 |
![]() | Endonuclease |
![]() | MLFDYVRIRFPTTDVQQVVENILQLKLSYFLHEDYGFYSYSEHYALGDIFVLCSHELDKG VLVELKGRGCRQFESYLLAQQRSWYEFFMDVLVAGGVMKRLDLAINDKTGILNIPVLTEK CQQEECISVFRSFKSYRSGELVRKEEKECMGNTLYIGSLQSEVYFCIYEKDYEQYKKNDI PIEDAEVKNRFEIRLKNERAYYAVRDLLVYDNPEHTAFKIINRYIRFVDKDDSKPRSDWK LNEEWAWFIGNNRERLKLTTKPEPYSFQRTLNWLSHQVAPTLKVAIKLDEINQTQVVKDI LDHAKLTDRHKQILKQQSVKEQDVITTKK |
[1] Rocco JM et al (2006) The integrase of the conjugative transposon Tn916 directs strand- and sequence-specific cleavage of the origin of conjugal transfer, oriT, by the endonuclease Orf20. J Bacteriol. 188(6):2207-13. [PMID:16513750] |
# | ID | Name | GenBank | Length | Note |
1 | 303 | Int_Tn916 ![]() | AAB60030 | 405 aa | Int apparently plays a dual role in the movement of the transposon from the donor to the recipient. Integrase;Accessory protein |
![]() | 215 |
![]() | Orf21_Tn916 ![]() |
![]() | _ |
![]() | AAB60012 |
![]() | TrwB/TraD |
![]() | 461 |
![]() | Q47727 |
![]() | _ |
![]() | FtsK_SpoIIIE [PF01580.17], Evalue: 2.50E-07, Aligned region: 206..313 DUF87 [PF01935.16], Evalue: 4.40E-05, Aligned region: 216..352 |
![]() | The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. |
![]() | MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPY LIISFSVAILICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDS AGRTKEKITYFPKMYYRLKNGLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKD SYVEYTLLYDTIASRISIDEVEAKDGKLRLMKNVWWEYDKLPHMLIAGGTGGGKTYFILT LIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLLSCIETFYEEMMKRSEEMKQM KNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLGRQAGFFLILA CQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD |
[1] Rocco JM et al (2006) A modular master on the move: the Tn916 family of mobile genetic elements. J Bacteriol. 188(6):2207-13. [PMID:16513750] |
![]() | 6 |
![]() ![]() | ICE (Conjugative transposon) |
![]() | Tn916 |
![]() | 45 |
![]() | U09422.1 |
![]() | Tn916 |
![]() | 18032 bp |
![]() | 2441..2656 [+] |
![]() | ![]() |
![]() | _ |
![]() | _ |
![]() | _ |
![]() | Enterococcus faecalis DS16 [1158677] |
[1] Flannagan SE et al (1994) Nucleotide sequence of the 18-kb conjugative transposon Tn916 from Enterococcus faecalis. Plasmid. 32(3):350-4. [PMID:7899523] |