![]() | 842 |
![]() | MobC_pJJ1887-3 ![]() |
![]() | WP_000955999 |
![]() | Other |
![]() | 107 aa |
![]() | _ |
![]() | _ |
![]() | MobC [PF05713.10], Evalue: 1.20E-12, Aligned region: 50..94 |
![]() | putative relaxase |
![]() | MLTIRVTDDEHARLLERCEGKQLAVWMRRVCLGEPVARSGKLPTLAPPLLRQLAAIGNNL NQTARKVNSGQWSSGDRVQVVAALMAIGDELRRLRLAVREQGARDDS |
![]() | 1230 |
![]() | pJJ1887-3 |
![]() | NZ_CP014319.1 |
![]() | ColRNAI |
![]() | 5631 bp |
![]() | 5253..5336 [+] |
![]() | _ |
![]() | _ |
![]() | _ |
![]() | _ |
![]() | Escherichia coli JJ1887 [1355101] |
[1] Johnson TJ et al (2016) Complete Genome Sequence of a CTX-M-15-Producing Escherichia coli Strain from the H30Rx Subclone of Sequence Type 131 from a Patient with Recurrent Urinary Tract Infections, Closely Related to a Lethal Urosepsis Isolate from the Patient's Sister. Genome Announc. 4(3). [PMID:27174264] |