ID | 842 |
Name | MobC_pJJ1887-3 |
GenBank accession number | WP_000955999 |
Family | Other |
Length | 107 aa |
UniProt ID | _ |
PDB ID | _ |
Pfam | MobC [PF05713.10], Evalue: 1.20E-12, Aligned region: 50..94 |
Note | putative relaxase |
Protein sequence [Download] | MLTIRVTDDEHARLLERCEGKQLAVWMRRVCLGEPVARSGKLPTLAPPLLRQLAAIGNNL NQTARKVNSGQWSSGDRVQVVAALMAIGDELRRLRLAVREQGARDDS |
ID | 1230 |
Plasmid name | pJJ1887-3 |
GenBank accession number | NZ_CP014319.1 |
Incompatibility group | ColRNAI |
Genome size | 5631 bp |
Coordinate of oriT [Strand] | 5253..5336 [+] |
Drug resistance | _ |
Heavy-metal resistance | _ |
Virulence factor | _ |
Xenobiotic degradation | _ |
Host bacterium [NCBI Taxonomy ID] | Escherichia coli JJ1887 [1355101] |
[1] Johnson TJ et al (2016) Complete Genome Sequence of a CTX-M-15-Producing Escherichia coli Strain from the H30Rx Subclone of Sequence Type 131 from a Patient with Recurrent Urinary Tract Infections, Closely Related to a Lethal Urosepsis Isolate from the Patient's Sister. Genome Announc. 4(3). [PMID:27174264] |