ID | 779 |
Name | MobC_pVR50D |
GenBank accession number | WP_046072959 |
Family | Other |
Length | 107 aa |
UniProt ID | _ |
PDB ID | _ |
Pfam | MobC [PF05713.10], Evalue: 1.50E-11, Aligned region: 50..94 |
Note | putative relaxase |
Protein sequence [Download] | MLTIRVTDDEHARLLERCEGKQLAVWMRRVCLGEPVARSGKLPTLAPPLLCQLAAIGNNL NQTARKVNSGQWSSGDRVQVVAALMAIGDELRRLRLAVREQGARDDS |
ID | 1167 |
Plasmid name | pVR50D |
GenBank accession number | NZ_CP011138.1 |
Incompatibility group | ColRNAI |
Genome size | 5631 bp |
Coordinate of oriT [Strand] | 866..949 [-] |
Drug resistance | _ |
Heavy-metal resistance | _ |
Virulence factor | _ |
Xenobiotic degradation | _ |
Host bacterium [NCBI Taxonomy ID] | Escherichia coli VR50 [941323] |
[1] Beatson SA et al (2015) Molecular analysis of asymptomatic bacteriuria Escherichia coli strain VR50 reveals adaptation to the urinary tract by gene acquisition. Infect Immun. 83(5):1749-64. [PMID:25667270] |