ID | 622 |
Name | MobC_pJJ1886_3 |
GenBank accession number | WP_000955999 |
Family | Other |
Length | 107 aa |
UniProt ID | _ |
PDB ID | _ |
Pfam | MobC [PF05713.10], Evalue: 1.20E-12, Aligned region: 50..94 |
Note | putative relaxase |
Protein sequence [Download] | MLTIRVTDDEHARLLERCEGKQLAVWMRRVCLGEPVARSGKLPTLAPPLLRQLAAIGNNL NQTARKVNSGQWSSGDRVQVVAALMAIGDELRRLRLAVREQGARDDS |
ID | 1010 |
Plasmid name | pJJ1886_3 |
GenBank accession number | NC_022662.1 |
Incompatibility group | ColRNAI |
Genome size | 5631 bp |
Coordinate of oriT [Strand] | 5253..5336 [+] |
Drug resistance | _ |
Heavy-metal resistance | _ |
Virulence factor | _ |
Xenobiotic degradation | _ |
Host bacterium [NCBI Taxonomy ID] | Escherichia coli JJ1886 [1355100] |
[1] Andersen PS et al (2013) Complete Genome Sequence of the Epidemic and Highly Virulent CTX-M-15-Producing H30-Rx Subclone of Escherichia coli ST131. Genome Announc. 1(6). [PMID:24309736] |